SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000136129|PACid:22668022 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000136129|PACid:22668022
Domain Number 1 Region: 78-186
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 9.42e-28
Family alpha-D-mannose-specific plant lectins 0.0033
Further Details:      
 
Weak hits

Sequence:  MDP0000136129|PACid:22668022
Domain Number - Region: 296-321
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0176
Family EGF-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000136129|PACid:22668022
Sequence length 367
Sequence
MNSTKWVAQMKNILLIFQLFVLPSCIFSFDTITLNKPIKDGDVLTSSKKFFALGFFSPGN
SRNRYVGIWYNKVPEQTIVWVANRNNPVTNTSGLLAVISHGGLVIYGNEKSTPLWSANVT
ASSPNNSVIAKLLDTGNLVVVENNGKVLWQGFDYPSNTLLPSMKIGLDRRSGLNRFLTSW
KSQDDPGIGNCSYRIEPSESPQLFLYKGQTPFWRGGSWTGERWSGVPVMTKNFIFNATFV
NNEDEVSVMYSIVDESIFSKMVIDESGIVERSTWHDQVRQWVKFWSAPVEQCDFYGKCGP
NSNCDPYIADEFECNCLPGFEPKLQHEWYLRDGSGGCVRRNGSSVCQNGEGFVKLERVKV
PYSSATX
Download sequence
Identical sequences MDP0000136129 MDP0000136129|PACid:22668022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]