SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000137211|PACid:22645789 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000137211|PACid:22645789
Domain Number 1 Region: 36-320,489-544
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.59e-47
Family FAD-linked reductases, N-terminal domain 0.000000298
Further Details:      
 
Domain Number 2 Region: 324-490
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.63e-22
Family GMC oxidoreductases 0.00000278
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000137211|PACid:22645789
Sequence length 550
Sequence
MEKSTTAAILLVFYIFVLCPQPGIHSLAPPSDVRDFSYLKFVRNATDLPLQEEYDYIVVG
GGTAGCPLATTLSANYSVLLLERGDIPTTYPSVSTVEGILENFMLEDDGTTPLQRFVSED
GVANVRGRILGGTSMVSGGAYSRADSEFYKKSGIKLDMNLVNKSYEWVEDTIVFRPNVSQ
WQSVVKDALLEAGVRPDNGFTLDSVEGTKISGALFDNRGRRYGAVELLNKGHPKNLRVAI
HATVERIIFSSKASDPSAKGIIYNDSNGRSHWASIRGKGEVILSAGAIGSPQLLLLSGVG
PKSYLTSLKIPVVHPQPYVGKFMRDNPRSNIIILPPSPIVPTYSQIAGFTSDFDIESISG
TPYSSQAYSIFPNPTIPVTINSSFGFFMVKVRGPILSHGSLKLQSSYDAKVAPNVKFNYF
AKEGDLSQCVSAMGKMRDLLKTNALKPFKTRDLPGLEGFNLFKPSLPMNQSDDASFCRDT
VATHWHYHGGCSAGKVVDGDLRVTGIKALRVVDGSIFNSSPGTNPQATLMMLGRYVGLRI
LEERSASKGR
Download sequence
Identical sequences MDP0000137211 XP_017186296.1.92800 MDP0000137211|PACid:22645789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]