SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000140844|PACid:22672797 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000140844|PACid:22672797
Domain Number 1 Region: 77-186
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.97e-26
Family alpha-D-mannose-specific plant lectins 0.0061
Further Details:      
 
Weak hits

Sequence:  MDP0000140844|PACid:22672797
Domain Number - Region: 351-406
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0173
Family Anti-platelet protein 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000140844|PACid:22672797
Sequence length 447
Sequence
MQSCKALRSFFMCLFFLFSLLRISAATALGTITPSQYIRDGETLVSVGGSYELGFFSPGK
SKSRYLGIWYNFSTDAIVWVANRETPLGDYSGLLKLTKQGVLVLLNSSNSIVWSSKASRI
VGNPVSQLLDSGNLVVQDANETNPDDFLWQSFDYPCDTHLPKMKIGWDLVTGLDRSLSSW
KSTEDPAPGEFLIRMDYRGLPQLLLMKGAKILARPGSWNGLYLTGLGYRFREPNPISAFE
FVLNKDEVYFQYSLRSTSVFSRTVLSPSGVVEQFTWVHQKQSWDLPVTFLADRCQSYALC
GPFSSCSINNFNTPICACFKGFVPKSLKDWNSGYWSDGCVRRTPLACSDGDGFIKYSGMK
LPDTSTSWFDKSTSLKECKGLCLGNCSCTACANLDIREGGSGCVLWFDNLTDIKEFTPNG
GQDLYIRVAASELGTSSTFICSMQSRV
Download sequence
Identical sequences MDP0000140844 MDP0000140844|PACid:22672797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]