SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000149205|PACid:22670334 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000149205|PACid:22670334
Domain Number 1 Region: 20-80
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000294
Family FAD-linked reductases, N-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000149205|PACid:22670334
Sequence length 104
Sequence
MEGNLRFCFAEGGETKKKMFISVDCMVVGGGISGLCFAQVLATKHDDTVPNVIVTEARDR
MGGNIITIEKDDYPGAETAAASGGRTQLNCIVVLERINKRVFTV
Download sequence
Identical sequences MDP0000149205 MDP0000149205|PACid:22670334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]