SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000150260|PACid:22663964 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000150260|PACid:22663964
Domain Number 1 Region: 512-622
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.67e-28
Family Protein kinases, catalytic subunit 0.00096
Further Details:      
 
Domain Number 2 Region: 80-189
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.89e-26
Family alpha-D-mannose-specific plant lectins 0.0035
Further Details:      
 
Domain Number 3 Region: 364-429
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000259
Family Anti-platelet protein 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000150260|PACid:22663964
Sequence length 626
Sequence
MSLLIAGLLKLIVVLSLMLLPFSFXTASKHNNLLVPGHSIIARQTLISSSGNFALGFFRP
AKSTKYFLGIWYNAMPNPPIVWVANRDSPLNSPGVLMLRSDGNLVVLENEAIIWSSNASV
PASAMSSTIGLLMDSGNFVLQLGEELDKNPLWQSFDHPSDTLLPGMKISLNKRTGQQRRL
TSWSAVDDPKPGNFSAGIYPKVPAQIVVWKENIGDHPYWRTAVYNMNGHKSKSIVIRNLS
GTFLFLSYNFDLHDHHDNDNDEIYFNYSSPDISSVKMRSVLDPNGLLVLLLWQDESEKWS
ELWREPVDKCDFYAPCGPYAACTRNETVSPCKCVTGFVPKFEQQWDMGDWTGGCVREKGL
KCNRNREGFSKLEKLKLPDHAVLVGDKKSRTECEAECLQNRSCTAYVYANVAQEISSMRC
ITWYGDLVDLVENHTLGQDIYIRVHEDDCNDCDGCKGHVEIFLKQRSDVIAIAIVSAIVG
ILATIFGYLLWKKTVRNEGKAGGGRNDTDQLPPFSLKSILAATNNFSDTNKIGEGGFGPV
YKGTLPENQEVAIKRLSKKSGQGHREFINELELIAKLQHTNLVRLLGFCNEEEEMILIYE
YLPNRSLDKFLFGIDMLITLEILCIC
Download sequence
Identical sequences XP_008362286.1.92800 MDP0000150260 MDP0000150260|PACid:22663964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]