SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000160883|PACid:22627691 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000160883|PACid:22627691
Domain Number 1 Region: 513-734
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-68
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 78-152,187-217
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.54e-22
Family alpha-D-mannose-specific plant lectins 0.0027
Further Details:      
 
Weak hits

Sequence:  MDP0000160883|PACid:22627691
Domain Number - Region: 212-308
Classification Level Classification E-value
Superfamily Fucose-specific lectin 0.00785
Family Fucose-specific lectin 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000160883|PACid:22627691
Sequence length 748
Sequence
MASTYFSTYLVALFFLVVAGFDACSASRIGLGSRLLARENQTLVSDNGTFALGFTPTSDD
DYRLQLAIWFAELPGDRTIVWSANRNSAVSNNAILELDTTGNLVLTDGDATTWTSNTSGT
GVEGXTLQESXNFVIYNDVKGPVWQSFSHPSDTLLPNQPLSVSLELTTSKSPSHGGYYAL
KMLQQRTSLSLALTYNVPETLYNSSPESYYNYSYWNGPDISNVTGDVVAVLDEAGSFGIV
YGESSDGAVYVYKNDGDNGGLSAASNISTRSSVLRRLILESNGNLRLYRWDNDVNGSRQW
VPEWAAVSTPCDIAGICGNGICNLDRSKTNASCTCLPGTYMVDGGSQCSENSSLIGKCDP
RSNYQPSQFRTSTVQQTNYYFPEFSVIANYSDVDNVSKCGDICLTDCECVASVYSLDDES
PYCWVLRSLGFGGYEDPGSTLFVKIRSNGSEGDAQGSGESSKGSGNRRTKVLVIPIVLSM
TFLVALLCLLLYYNVHRRRSLKRTLESLVILSGAPLNLSYRELQIRTWNFSQLLGTGGFG
SVYKGSLADGTLVAVKKLERVLPHGEKEFITEVNTIGSMHHMNLVRLCGYCSESSQRLLV
YEFMKNGSLDKWIFGSRYSRDKVLDWQSRFDIAVGTAQGIAYFHEQCRDRIIHCDIKPEN
ILLDENFCPKVSDFGLAKMMGREHSQVVTMVRGTRGYLAPEWVSNRPITVKADVYSYGML
LLEIVGGRRNLDMSFDADNFFYPGWAFK
Download sequence
Identical sequences MDP0000160883|PACid:22627691 MDP0000160883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]