SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000175499|PACid:22652375 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000175499|PACid:22652375
Domain Number 1 Region: 77-187
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.83e-19
Family alpha-D-mannose-specific plant lectins 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000175499|PACid:22652375
Sequence length 295
Sequence
MNSTEFFFVSTVLLXFLVILPSSISVTLDAITXNQPLREXDVLLSTTKXFALGFFKPGNS
XNRYIGVWYNKIPIXTIVWIANRENPIVPTAGTGLLAIHXDHGGLVXYGEDQNTPIWSXN
LTVSSPNNSVIAKLSNKGNLXVEINGEKVWQGFDYPTNTMLPFMKIGLDRRSRLNRFLTS
WKSQDDPGMGNCSFRMEPSESPQEFLYKGQTRLWRTGPWTGERWSGVPGIVKLFFTNVTF
VNNXDEVSIMDLVPESSFVKLVIDESGNIERSAWDDEVHKWVPHWSPDWQCDSYG
Download sequence
Identical sequences MDP0000175499 MDP0000175499|PACid:22652375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]