SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000176385|PACid:22669746 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MDP0000176385|PACid:22669746
Domain Number - Region: 326-418
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.022
Family FAD/NAD-linked reductases, N-terminal and central domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000176385|PACid:22669746
Sequence length 451
Sequence
MSLLIMQNSVXEHVGGGIPSCDLAKAYLDKIEEKFKRSDKAETGVLLSALINTKHDGSGS
VREHLLKLVNLANKLNAMDIGITDQVLVHMALYSLSTNNEQFKVSYNTQKKFXSVNELIS
ICCQEEKRLKKSKTDRQEFANLLNVGKGKDINQIRFYVQSQFDNLIGYAFPYGDLWKIQY
TYYQECLNVEHSIPKCMLTXDKSFMLWHQKLGHISMERIMRLVKDGMLPQLNFTDAMKCI
DCIKGKITNSTNKANTTSIPRTAQHPRTYKLQTMTTQSSTAKWKKSKVAVIGSGINGRQH
WRSGTRLLILPRCKPLKNFTSSQILHGRIPQLAVIGFSESISNLYTSKMRCRWLAELLGG
TFKLPCTKEMEKHVEKWDTYXKRHASSXYYQRSCXGVLHLWYKDQLYKDMGWNPKRNPSA
LVGIHGQGRMKSSSKRRSIQRPGWSWDPPKV
Download sequence
Identical sequences MDP0000176385 MDP0000176385|PACid:22669746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]