SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000177272|PACid:22623675 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000177272|PACid:22623675
Domain Number 1 Region: 72-165,193-210
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.1e-28
Family alpha-D-mannose-specific plant lectins 0.0042
Further Details:      
 
Weak hits

Sequence:  MDP0000177272|PACid:22623675
Domain Number - Region: 318-367
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0188
Family Pan module (APPLE domain) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000177272|PACid:22623675
Sequence length 391
Sequence
MQFPTFTMSLFSFFLFSLFAFIAQAQVPANQTFTYVNEGEFGPFITEYDASYRMLDPFXA
PFQLAFYNTTPNAFSLALRMGLRRSESLFRWVWEANRGNPVGENATLTFGTNGNLILAHA
TGKVAWQTNTANKGVVGFKLLPNGNMVLHNSKGKFIWQSFDYPTDTLLMGQSLRAGAVSK
LVSRAVEKENKDGPYSLVMEPKGLALYYKSSTLQNRNSTSHFLNELLFRTHWLGIDGNVK
FYTYNDKVDIGAWEVTFALFDRDNLIWEXECQLPEQCGTFGLCEDSQCVACPSSKGLLGW
SKSCAPEKLTSCDAKSFHYYKVEGVDHFSSKYTSGAAMKENDCAKKCTSDCKCLGYFFKQ
DTSRCWIAYDLKTLTKVANSTHVGYIKAPNH
Download sequence
Identical sequences MDP0000177272 MDP0000177272|PACid:22623675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]