SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000183818|PACid:22666414 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000183818|PACid:22666414
Domain Number 1 Region: 449-752
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.36e-80
Family Protein kinases, catalytic subunit 0.0000804
Further Details:      
 
Domain Number 2 Region: 101-199
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000103
Family alpha-D-mannose-specific plant lectins 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000183818|PACid:22666414
Sequence length 797
Sequence
MEQSTVETEAAGSVAKDVSSLSRGLNINGSFLSSSHAQTLDFPVLLKQGQRLADRDRNYL
VSENGGLFKLGFLSPGTSSASGATSYRYLGMFYTSLPSHPDAVWLANPKTPISDSSGVFT
LDSDGKLKIVYSGGEISVSDSNQTVSGMNFKTGQNWTLFSWLSDQVPEPGAFKLGXDPGA
AXQLVIWRXGDVYWTSGVWXNGSFXGSPELTRRVDLFEFTFVSSKEEKWELSLQGQISQS
XLAPNKTTWESTVTGPCKLNMNYPDAMCIEEKITECRNXSELFVPIRGYFAAVKFLYXDD
DTSLAISDCHAXCWRNCTCIGYESLYTXNGTGCVYMMEGAKFEEXDYXGFTYILTIXXNS
SKDGTPTEEGKKIGSAGSVAKKWWIWFIISITLSVTVLLLGYLCYIRKIKRRFMQHTGXE
QGLXELRXQITRIXNVHRLKLGKSIGQEFQMFSFSGIVAATNNFSSGSKLGEGGFGPVYK
GVLPDGQQVAVKRLARNSGQGLEELRNEITLIAELQHRNLVRILGCCIQGEEKILIYEYL
TNASLDAFLFDSTKGKHLDWQQRVNIIEGIAQGLLYLHKYSRVRIIHRDLKASNILLDGN
XNPKISDFGMARIFEQNESTSKTKRVVGTYGYMSPEYAMKGIFSDKSDVYSFGVLLLEIV
SGKKNTEFVSSTALSLVELXWDLWKQGXTQELKDTXVDSCPEDEVLKFIHLSLLCVQEYA
ADRPTMAEVVSMLXSDSMFFPDPKQPAYHISRSEVGLCAHNCDGSQVIFAIEQFVSNQSF
EDDVLRKKLAVVXQRRN
Download sequence
Identical sequences MDP0000183818|PACid:22666414 MDP0000183818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]