SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000185400|PACid:22669041 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000185400|PACid:22669041
Domain Number 1 Region: 60-137
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.57e-16
Family alpha-D-mannose-specific plant lectins 0.0057
Further Details:      
 
Weak hits

Sequence:  MDP0000185400|PACid:22669041
Domain Number - Region: 200-243
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.051
Family Pan module (APPLE domain) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000185400|PACid:22669041
Sequence length 274
Sequence
MDVHKLLIFLLFATASGWSQGGLQSLRQGSSLKVEEESHSLVSPNGAFSSGFYNVGKRAF
CYAIWYTNSINKTVVWMANRDRPVNETRSRLTLRRNGNLVLTDGIGSTVWXTNTFSGVGM
EVRLLETGNLVPIRTWNITWLPNAIDTCQVHGLCGEYRICYLQSATYLYLPSWFLPKGSF
KLVKRLLTFSHLSHDSNKLDFMEIPNSDYFAYDLDTTAIGIPYEECRDACLYDLRCKGFG
YARDGSGWLSKSGKEQQNSVHGIPNWVCELISDN
Download sequence
Identical sequences MDP0000185400|PACid:22669041 MDP0000185400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]