SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000188391|PACid:22626210 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000188391|PACid:22626210
Domain Number 1 Region: 40-314,416-485
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.27e-77
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.000000402
Further Details:      
 
Domain Number 2 Region: 508-649
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 1.7e-47
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00014
Further Details:      
 
Domain Number 3 Region: 291-412
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 3.74e-40
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00000954
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000188391|PACid:22626210
Sequence length 649
Sequence
MWRCVSRGLGVSSSKRSASGDSLRSHFPRLFSSESATGRSPYTVVDHTYDAVVVGAGGAG
LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL
GDQDAIQYMCREAPKAVIELENYGLPFSRTEDGRIYQRAFGGQSLDFGKGGQAYRCACAA
DRTGHALLHTLYGQAMKHNTQFFVEYFALDLLMDSEGLVLYADALVYYQGTCQGVIALNM
EDGTLHRFQASSTILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTG
IYGAGCLITEGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGLLS
SGPLKDHIYLHLNHLPPDVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTN
YHGEVLTIKGDDPDSIIPGLMAAGETACASVHGANRLGANSLLDIVVFGRACANRVAEIH
KPGEKQKPLAKDAGEKTIAWLDKIRNSNGSLPTSKIRLNMQRIMQNNAAVFRTQETLEEG
AQLIDKAWESFHEVQLKDRSLIWNSDLIETIELENLLINACITMHSAEARKESRGAHARE
DFTTRDDEKWIKHTLGYWENEKVRLDYRPVHMNTLDDEIETFPPKARVY
Download sequence
Identical sequences MDP0000188391 MDP0000188391|PACid:22626210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]