SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000197354|PACid:22655668 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000197354|PACid:22655668
Domain Number 1 Region: 74-167
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.88e-16
Family alpha-D-mannose-specific plant lectins 0.019
Further Details:      
 
Weak hits

Sequence:  MDP0000197354|PACid:22655668
Domain Number - Region: 332-388
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0102
Family Anti-platelet protein 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000197354|PACid:22655668
Sequence length 415
Sequence
MQALTSFFMCLFFLLSLLRISAATALVTITPSGYIRDGETLVSVGGSYELGFFSPGKSKS
RYLGIWYTASADAVVWVANRETPLGDSSGFLKLTEKGVLVLLNSSNSXVXEFIKNCGESN
GKETNPDNFLWQSFDHPCDTFLPEMKLGWDLVTGLERYLSSWKSTEDLAPGEFSGRMDLR
GLPQLFIMKGSKIHSRGGSWNGLYLTGYGYGPREPNPISGSELVMNKDEVYYEYRLRNMS
EFSRFVLNPLGVAERFTWVYKTQSWELADKFLADRCESYALCGLFSSCSINTNSPICACL
KGFVPKSLKDWNSGYWSDGCVRRTPLACSDGDGFVKYSGIKLPDTSTSWFDKSTSLKECK
GLCLGNCSCTACANLDIRQGGRGCVLWFGNLIDIKEFTPGGGQDLYIRVAASELX
Download sequence
Identical sequences MDP0000197354|PACid:22655668 MDP0000197354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]