SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000203847|PACid:22681509 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000203847|PACid:22681509
Domain Number 1 Region: 504-1072
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 6.54e-91
Family Acetyl-CoA synthetase-like 0.00047
Further Details:      
 
Domain Number 2 Region: 1687-2051
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 2.49e-64
Family Allene oxide synthase 0.00036
Further Details:      
 
Domain Number 3 Region: 21-279
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.5e-28
Family FAD-linked reductases, N-terminal domain 0.036
Further Details:      
 
Domain Number 4 Region: 1585-1703
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 0.00000000000194
Family PglD-like 0.079
Further Details:      
 
Domain Number 5 Region: 1113-1190
Classification Level Classification E-value
Superfamily ACP-like 0.000000000432
Family Acyl-carrier protein (ACP) 0.0094
Further Details:      
 
Domain Number 6 Region: 1349-1427
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 0.00000122
Family Galactoside acetyltransferase-like 0.019
Further Details:      
 
Domain Number 7 Region: 2192-2303
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 0.000013
Family Galactoside acetyltransferase-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000203847|PACid:22681509
Sequence length 2310
Sequence
MDPGKSVEDQFSRLHPCLPLNTRIGIVGGGPSGLSSAYALVKXGYSNVTVLEKHHTVGGM
CESVXIEGKIYDLGGQVLAANSAPVIFHLAKETGSELDEMDSHKLALIDKSGQYQDIKVA
DDYVSVISLTLELQDKAAKSGRIGVHAVSEYASDLTPVYLEHQGFSSVPKSVAYGYTASG
YGFVQDMPYAYIHEFTRTSMAGKIRRFKGGYTSFWEKISKSLPMVHCNTEVLEIRRYSDS
VXVVVKSCDGEVKSMEFDKIIISGSFPLNSGRIYRSPSHPTEHGSEVMEMGDVEKELFSK
VETIDYYTTVLKVKGIEXMXIGFFYFEEYMSNPATIGNPVAMQKFYADTDILLFWSYGNS
VDITGPTVTELAIDAAKLIGAEVMEVVLQRRFKYFPHVGSQEMKDGFYEKLESELQGFKN
TYYVGGLMAFELTERNSSYAMGLVCKHFANDNSVPKFPYAKSLFTLQQRWGGSPKCMTEV
PGVEFPNLSSLDGYLKHWGAHGVAQNKALYIWINEEGAVMSQXTYAELHANASCIAQKLL
TCKKPVIRPRDRVLLVHVPGLDFVDAFFGCLRANVLPVPVLPPDPLQRGGQALLKIENIA
KSCGAVAILSTISFHWAVQAGSVKNMISLTAKKPKSSGHWPNLPWLHTDSWIKNSKNVVV
EDFKDEIEPQPDEVSFLQFTSGSTGDAKGVMITHGGLIHNVKLMRKRYNSTSKTVLVSWL
PQYHDMGLIGGLFTALVSGGTAVLFSPLTFIRNPLLWLQIMSKYQATHSAGPNFAFELVI
RRLESDKNGKYDLSSMKFLMVAAEPVRQKTLKRFVELTRPFGLSQEVMAPGYGLAENCVF
VSCAYGEXKPIMVDWQGRVCCGYVNPGDEDVDIRXVDPESGEELKEAGKEGEIWISSPSA
GIGYWGREELSQNTYXNKLPDHPGRIYTRTGDLGRIIDRKLFITGRIKDLIIVAGRNIYS
ADVEKTVESAAEVVRPGCCAVISVPMEILSMKGISVPDNADQVGLVVIAEVRDGKPVGKD
VVEQIQARVAEEHGVTVAXVKMIRPKTISKTTSGKIKRFECLQQFXDGTLNVVPEPILTK
KKLMRSFTTGTCKEGITPRPQFVRGSPPPXPKISNKDIVDFLKRLVSEQTGISINKISNT
ESLVSYGIDSIGVVRAAQKLSDFLGVPVGAVDIFTATCIADLASFSENLVMNSQXQLSTT
PSNVXXLETETDSAELVMELPESHHLVIWXFQLLALVYXAFMLSIPAYISVSAFMKCVSA
THALVXGIPYLDYLILLTFAPLAWILCILSTCVSIAFLGNSFLKPNYALNPEVSIWSVDF
VKWWALYKAHEVASKVLAEHLRGTMFLKYWFEMLGARIGSSVFLDTVDITDPSLVSIGDG
AVIAEGALIQSHEVKNGVLSFLPIRIGQNSSVGPYAVVQKGTILGEDLEVMALQKSGGKS
AAKATNLQNGKMPPNVTKETQDGVLYQFIGIYIVGLLSTLSASIVYLVYIWXSQKPLSPX
EFAFACLFGXFHWMPYTVIAYATMFSNVPLGIIYSSISMAVAYLAYGIVLSFLTAALTRL
ISSNQEKKTTHFRXWXCHRITIACHHRFAKLLSGTEAFCMYMRLLGAKVGKHCSIRAINP
ISDXKLXSLGSGVHLGDFSRIIAGYYSSHGFVSGKVEVHDNSVVGSESVVLPGSVLQKDV
ILGALSVAPVNSVLKAGGVYIGSQTPMMIKNTMHSLEDRIEEMDMKYKKIVGNLAANLAA
TTLKVKSRYFHRIGVSGKGTLKIYDNIKGLPDHKIFXPGKSYPVIVRHSNSLSADDDARI
DARGAAIRILSDESSESSLFDLTLKTGKAFYARTIADFATWLVCGLPAREEYVKRAPHVR
DAVWTSLRHANSYAELHYYSNICRLFRFEDGQEMYVKFKLRPSDENIGEEAGKVEPIGIL
PPDTGAIPRNDNDTRPLLFLAKDFQSRVNXEGXRYIFQLQVRXVPHDEAARDIALDCTKP
WSESEFPYIDVGEVNINHNLSAEQSEQLDFNPFLRCHEVDVIRASSCSQSASIDHGRSLI
YEICQHLRNGAPLPEAWKIFLEQSDVKVDLSGCPMAASLMKKDXQKVTLERTLLQTLWAT
FAQPLLQTVLPHFLLALVIYAPLNWTLHLKNAQKITLHWLLPLFWVSSGLLAGLACVVAK
WLLVGKKKEGETVHIWSIGVFLDTXWQAFRTLVGSYFAEMTSGSIFFXLWMKLMGSEIEL
DQGAYVDSMGALLNPEMVEIERGGCVGREALLFGHIYEGDEGKVKFGKISVGEGGFVGSR
AIAMPGVRVEVGGSLSALSLAMKEEIIMSR
Download sequence
Identical sequences MDP0000203847 MDP0000203847|PACid:22681509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]