SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000205220|PACid:22620134 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000205220|PACid:22620134
Domain Number 1 Region: 65-156
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.1e-18
Family alpha-D-mannose-specific plant lectins 0.0062
Further Details:      
 
Weak hits

Sequence:  MDP0000205220|PACid:22620134
Domain Number - Region: 277-319
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000221
Family Protein kinases, catalytic subunit 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000205220|PACid:22620134
Sequence length 320
Sequence
MAVALSVEMLLFSLFLLPISVISQNNGRVAVGSSLTATXGDSSSWLSPSGDFXFGFSPLG
NNDXFLLSIWYANIPDKTVVWYAYDGNNPMVAPRGSVLNLTANSGLVLNNPQGGEIWKSE
XTLGTVANGVMNDTGNFVLQHQNSGSLWETFSXPTDTVLPGQTIERNGXLSCRQSETNYT
KGRTCXLKPDKRPTCECPKGFSFLDPKDIYRGCKPDLSRKSVTRVESVLLDKWVWIGISI
AAALVLCTAYYLXRRRRSALAXAGENRTTLENEMLIFMKSKRHHDFSVFSYSSIXAATXN
FAEENKLGQGGFGPVYKVXF
Download sequence
Identical sequences MDP0000205220|PACid:22620134 MDP0000205220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]