SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000212715|PACid:22662825 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000212715|PACid:22662825
Domain Number 1 Region: 402-555
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.98e-28
Family Protein kinases, catalytic subunit 0.0027
Further Details:      
 
Domain Number 2 Region: 74-183
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.84e-25
Family alpha-D-mannose-specific plant lectins 0.0057
Further Details:      
 
Weak hits

Sequence:  MDP0000212715|PACid:22662825
Domain Number - Region: 291-332
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0745
Family Anti-platelet protein 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000212715|PACid:22662825
Sequence length 578
Sequence
MQALRSFFTCLFXLFSXLRISAATXRGTITPSXYIRDGETXVSVGGSYELGFFNPVKSKS
RYLGIWYTVSTDAVVWVANRETPLGDSSGLLKLTEQGVLVXLNSSNSIXWSSHSSRIAGN
PVXQLLDSGNLVVQDGNETNPDNFLWQSFDYPCXTXLPEMKXGWDMVTGLERYISSWKST
EDPALGEFSIRMDQRGLPQVLIMKGARIQARLGSWNGLYLTGTGXGVXEPNPISGFEFVM
NKDEVXXDINSSFPICACXKGFVPKSLKDWNSGHWSDGCVRRTXXACSDGDGFVKYSGIK
LPDTSSSWFDKSMSLSECKGLCWXNCSCTACANLDIREXGSGCVLWFGNLIDIKEFTPGG
GQDLYIRVAASELGHRRKDCRDEYLGEDGEEMELPLFGFGPVYKISDFGLAKTFGGDQSQ
ANTNRVVGTYGYMSPEYAADGIFSMKSDVFSFGVILLEMLSRKKNRGFRHPDHDHNLLGH
AWILWIQDKPLELIDKTFCDSCNISEVVRCLHVGLLCVQRVPLDRPNMSSVVLMLSSDVA
LPPPKQPGFYIEGSVPESPTRTLPCSENTFSTTLIEAR
Download sequence
Identical sequences MDP0000212715|PACid:22662825 MDP0000212715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]