SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000217223|PACid:22622453 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000217223|PACid:22622453
Domain Number 1 Region: 339-585
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.32e-55
Family Protein kinases, catalytic subunit 0.00042
Further Details:      
 
Domain Number 2 Region: 66-155
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000000013
Family alpha-D-mannose-specific plant lectins 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000217223|PACid:22622453
Sequence length 601
Sequence
MAVALSVRMLLFFSLFLLPVSVFSQNNGRVAVGSSLTASTGDSSSWLSPSGDFAFGFSPL
GNNDFFLLSIWYAKIPDETVVWYAYDGNNPIVAPRGSVLTLTANGGLVLNNPQGGEIWKS
ETTFGIVENGVMNDTGNFVLQDKNSXSLWETSAIXQTPFCLDRQLRKXGSFRXDNRRLTT
QKGGSSCACKMMETSCSTPSTCQQILPTTLTSPRTRXQGLWKVVKLKPSTADKCNESCFQ
DCLCAVAVFRSETCWKKKLPLSNGRVDVSLNSQTFIKVRKDNVTLPFPPKPIXDDKEKSR
KSVIRVESVLLGTSIFVNFXLSSALCFGIFFIFRKKPVTSSTDIVLDSNLRSFXYEELRE
ATNGFTEELGKGAFGVVFKGVMQIGSGVEVAVKKLNYVMQDVEKEFKTELKVIGQTHHKN
LGLLYLHEECSTQIIHCDIKPQNILLDDYYTARISDFGLAKLMLMNQSQTHTAIRGTKGY
VAPEWFRNLPITTKVDVYSFGVVLLEIVCCRRSVDMEGNCEESAILTYWVYDCYVEGGLD
AVVDYEVEALGDRTTLEKFVMVAIWCIQEDPSLRPTMRKVVQMLEGVVEVPVPPCPSPYT
R
Download sequence
Identical sequences MDP0000217223 MDP0000217223|PACid:22622453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]