SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000217837|PACid:22654922 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000217837|PACid:22654922
Domain Number 1 Region: 163-238
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000468
Family Eukaryotic type KH-domain (KH-domain type I) 0.0021
Further Details:      
 
Domain Number 2 Region: 267-299
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000406
Family CCCH zinc finger 0.0013
Further Details:      
 
Domain Number 3 Region: 100-130
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000034
Family CCCH zinc finger 0.0027
Further Details:      
 
Domain Number 4 Region: 36-61
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000824
Family CCCH zinc finger 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000217837|PACid:22654922
Sequence length 327
Sequence
MDTRKRGRHEGGGFHSNGGFKKNKQELESFSTGVGSKSKPCTKFFSTAGCPFGESCHFLH
YVPGGYNAVAQMMNLAPAPPPPRNIPGPPSHSNGSNSSGVKSRICTKYNSPEGCKFGDKC
HFAHGEWELGKPLAQXHDDPRAMGPGPGRMGNWMEPHLAGPASSFGASSTAKISVDASHA
GAIIGKGGVHSKXICLRTGAKLSIRDHESNPNLRNIELEGTFEQIQQASAMVSELIATVS
TSGPGKAPGGGGGGGGGGGRGAPAPPRSNYKTKLCDNFTKGTCTFGERCHFAHGAAELRK
SGVCEWRLATRSGSPPYKIWKAEAVQL
Download sequence
Identical sequences MDP0000217837 MDP0000217837|PACid:22654922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]