SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000219292|PACid:22625575 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000219292|PACid:22625575
Domain Number 1 Region: 91-199
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.32e-27
Family alpha-D-mannose-specific plant lectins 0.0041
Further Details:      
 
Weak hits

Sequence:  MDP0000219292|PACid:22625575
Domain Number - Region: 239-306
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00451
Family Pan module (APPLE domain) 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000219292|PACid:22625575
Sequence length 346
Sequence
MTDKHSNHIMKNPSKASAKMXLLLFYSSLLLIVAAVFSTADDATSTFQSIRDGETVVSTG
GTFELGFYKYPDASNRRYVAIWYKQISVTTIVWIANRDKPLADLSGVLKVTSPGILVLNH
NMSTVWSSNTSRTAQNPVARLLDSGNLVVIDXSDDDSENFLWQSFDYPGDTFLPGMXIGR
NTVTGFNXHLRSWKSPQDPSQGNXTXQLGFTPKFPKEWDLVDWSDGCVRKTSLNCTGDVF
QKYSGLKLPSTEQSWFNRSMNLKECQMVCMKNCSCTAYTNLDIRDGGTGCLLWYGGLIDI
RYYSENGQDIYIRMAAAEQDYEDDAKINAKYSESNAKKMKIIIXTT
Download sequence
Identical sequences MDP0000219292 MDP0000219292|PACid:22625575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]