SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000222306|PACid:22645946 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000222306|PACid:22645946
Domain Number 1 Region: 9-253
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.49e-33
Family FAD/NAD-linked reductases, N-terminal and central domains 0.054
Further Details:      
 
Domain Number 2 Region: 317-496
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000194
Family FAD/NAD-linked reductases, N-terminal and central domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000222306|PACid:22645946
Sequence length 500
Sequence
MAPIVSKLGIIGAGVSGIAAAKQLAHYNPIILEASDSIGGVWRHCSYNSTKLQSHRCDYE
FSDFPWPDRDNTDYPSYLEILDYLKSYAEHFDVLKFVRFNSKVVEVRFVGDRETTDFDVK
PVEYQSLSXAGGQPVWEVAVQTNDSETIQWYAFEFIVVCIGKYGDXPQIPEFPLNKGPEV
FQGQALHTLDYCKLDKDAASELLKDKEVVVVGYKKSAIDLAVECAEANQGPEGKPCTMVV
RTLHWIVPHYWIWGLPFFLFYSTRSSQFXHQRPNQSFLRXLLCSLIMSPMGLKPDHPFEE
DYASCQMAIMPENFFSEADKGKIVFKRSTSKWWFSADGIEFDDNTKIKADVVVLATGYDG
KKKLKSILXXPFRSLLECPSGIIPLYRGTIHPLIPNMAFVGYLESVSNLHSSELRSIWLA
RLLDDKFKLPSVQKMLEQTSKEVEISKKTTRFYRRHCISTFSINHSDEXCEEMGWTSWRK
NTWLAEAFSPYGSQDYLNKH
Download sequence
Identical sequences MDP0000222306 MDP0000222306|PACid:22645946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]