SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000223576|PACid:22647879 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000223576|PACid:22647879
Domain Number 1 Region: 70-196
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.57e-20
Family alpha-D-mannose-specific plant lectins 0.0043
Further Details:      
 
Weak hits

Sequence:  MDP0000223576|PACid:22647879
Domain Number - Region: 297-337
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000471
Family Anti-platelet protein 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000223576|PACid:22647879
Sequence length 341
Sequence
MPELVEHLRKSRLLLCIFLAFLLNTLATSDIPLGSKISIADKTYGSLQMPGYSFGIRLIS
KIFPLDQQLLVWSAAADLIIGNNSYAQLTQDGELVLFDSLKGVTAWTSKTRQLSVVSAAL
NDNXNLVLLNQEKHIVWQSFDTPSDILLPGQSFSTLXTLRAASKNCVSSYYTLXMSASXQ
LQLXWESHVTYWXSGSLSSSNLSAFITSXGAXQLRDQXLKPVWSMSEDSKSWRSVWLAVE
NQCDVYATCGQRVICVFNDSGSPDCECLFKQQTNESTSRCFIPNNRCSSGSNMLHYKHTF
LHGMYPPTDDVVAKVSLEECKSLCQNDLTCTAATFSNDGTA
Download sequence
Identical sequences MDP0000223576 MDP0000223576|PACid:22647879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]