SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000231722|PACid:22646423 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000231722|PACid:22646423
Domain Number 1 Region: 63-172,646-682,720-753
Classification Level Classification E-value
Superfamily TPR-like 3.61e-25
Family Tetratricopeptide repeat (TPR) 0.0019
Further Details:      
 
Domain Number 2 Region: 216-258,420-498
Classification Level Classification E-value
Superfamily SET domain 0.0000000000000327
Family Viral histone H3 Lysine 27 Methyltransferase 0.061
Further Details:      
 
Weak hits

Sequence:  MDP0000231722|PACid:22646423
Domain Number - Region: 251-287
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0034
Family HIT zinc finger 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000231722|PACid:22646423
Sequence length 793
Sequence
MEKLKSLVPETLKRSIAASAADDLPRTCSSLADFLLHFEPFXQMVRDLADPEVALCGKNK
EAALEAKQKGNKCFLRSDYAEALDCYTQALRVAPMDVDEDRNLVXTLYTNRASVLQKLGL
LRECVQDCNRALQTSSNYAKAWYRRGKANASIGNYEDAICDLDVAKVLELSISGKRQIES
EMKIISDQHKSTIPSEQDNENNSNILDELXQMELQCVTTPEKGRGMTSTSDLPQASXVHT
EDPFAMIILKPCRETHCHYCLNELPADKVPCTSCSIPLYCSQKCRIQAGGKMCWDYPSNQ
NILENLSANLEKYIVDTTLNVESETDTEHIPEHKHECKXVHWPAVLPSEIVLAGRVLVKS
VIKRRGSTDTFHLSEISIVILISQIRVNSMTIVRMKSIDHHGLEDQFGKLTPWGEGLTSN
MEQVKVGQAIYISGSLFNHSCRPNIHAYFLSRTLFIRTTEFVTSGVPLEFSYGPQVGQWD
CXDRVKFLEDEYSFRCQCRGCLNVNFSNLALNGFHCVKPNCPGIVLDSGVVNIEREKLKY
LPRIVSTSSVEPHLQVEEFNTDEINKLAPHVQPNNVFDINPGFCLKCGSYRDXESSSAAA
DKARTRIXRLRDAIVSQDVSSTVLLDALSSLGLLRSTFFAYNRSIAEAEDNLAQAFCLVG
ELQPAMEHCKASIEILEKLYNPNHIVIGYELVKLSSLQLSLGDRAAADSINRLYQIFSCY
YGSHTMYEKFFSLDAAQXASWCDRGWVGSKYKRMGWCVWLTSAXKNFPTTXXDKFLGARI
XXTHKNPLEKTGK
Download sequence
Identical sequences MDP0000231722|PACid:22646423 MDP0000231722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]