SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000233802|PACid:22672706 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000233802|PACid:22672706
Domain Number 1 Region: 51-355
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.42e-44
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000972
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000233802|PACid:22672706
Sequence length 363
Sequence
MRFCLNPPKVLSLLKRACSAVGVAAAACLSSSPSSSSASTSTAPKLASAMDDLKTLRTKV
CIIGSGPAAHTAAIYAARAELKPILFEGMMANDIAPGGQLTTTTDVENFPGFPDGILGYD
LMDRCRKQSIRFGTEVFTETVNKVDFSTTPFKIFADERTVLADSVVVATGAVAKRLPFPG
SEEYWNRGISACAVCDGAAPIFRNKPLAVIGGGDSAMEEANFLTKYGSEVHIIHRRDTFR
ASKIMQNRALSNPKIRVVWNSEVVEAYGEGKGPLAGLKVKNVVTGEVSDFKVSGLFFAIG
HEPATKFLDGHLDLHADGYVATKPGTTQTSVKGVFAAGDVQDKKYRQAITAAGSGNSSSF
SKF
Download sequence
Identical sequences MDP0000233802 MDP0000233802|PACid:22672706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]