SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000234920|PACid:22652564 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000234920|PACid:22652564
Domain Number 1 Region: 95-207
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.31e-24
Family alpha-D-mannose-specific plant lectins 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000234920|PACid:22652564
Sequence length 292
Sequence
MIXXFXXXSVVLRQNAXKFCNXGFCERSAECFSSSXSXSIPELCSSXDTIKFXQRIREGD
FLESKNXTFVLGFFRPKMSNNSYVGIWYKFSEGMVVWVANRDNPINGSSGVLSIGSDGNL
ALQADTSEGLIPLWSTNVSISSASNDNIFAQILDSGNLVLAQQGSRXVFWQSTDHPTNIL
LPNTKMGLDRRSGINRFLTSWNSENDPGTGNVSLRIDPYGSPQLILYKIEAKLWRSGQWN
GIQWSGIPTVPKDVFKINFVNNKDEITSQWTALDPSIYSVYTVDYPGTFNLQ
Download sequence
Identical sequences MDP0000234920|PACid:22652564 MDP0000234920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]