SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000235420|PACid:22673852 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000235420|PACid:22673852
Domain Number 1 Region: 155-271
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.08e-21
Family Protein kinases, catalytic subunit 0.0036
Further Details:      
 
Domain Number 2 Region: 4-42
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000839
Family U-box 0.0022
Further Details:      
 
Domain Number 3 Region: 67-150
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000000103
Family alpha-D-mannose-specific plant lectins 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000235420|PACid:22673852
Sequence length 316
Sequence
MATRFPDDFKCPTSLEIMSDPVILSSGHTFDRASIQRWLDAGMAKFYSLVEKCLSLVDLQ
PQKIYXHYVGIWYKKDVEKRVVWVENRDNPVNDTSGILSTGANGDLFLYAENQSDIPLWS
AISNVSIASLPSNSTHEPNYKAQLLDTGNLEDSRLRIVHRDLKAINVLLDSVMNPKILDF
GMARIFGAEQIEANTNLEVGTYGYMSPEYAXERLFSVKSDESRALEIIDSSLGEPYPVNE
VLRCVHIXLLCVQEHAKDHPLMLVVVSMLXNDAAIPSPKQPGFLLKRSYHTSGDPSDNTE
GAYSINDMTHTEVEGR
Download sequence
Identical sequences MDP0000235420|PACid:22673852 MDP0000235420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]