SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000236651|PACid:22634860 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000236651|PACid:22634860
Domain Number 1 Region: 315-425
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.4e-24
Family Protein kinases, catalytic subunit 0.0032
Further Details:      
 
Domain Number 2 Region: 1-105
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000000144
Family alpha-D-mannose-specific plant lectins 0.0036
Further Details:      
 
Weak hits

Sequence:  MDP0000236651|PACid:22634860
Domain Number - Region: 123-147
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0472
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000236651|PACid:22634860
Sequence length 517
Sequence
MVLTDVDGTSVWETTANSTSSRVETTVLMDSGNLVLRDKQGKVLWQIFDFPTHIFLPNQP
LTKSKKMISTLGKSTFGTGYFSFSFDNDNVLKFMFDDPDTYWPDPDYTVFGCGWSPGKPI
ELCKVHGICINTTHPKCSCPPGYEVADTSDWKKGCKRMFNRLRSQQVKFVQIKQMDFYGY
YLNYSEPISFKNCNNLYLDDLWCEAFSYRKTGEGKCYTNSALFKWHMSPNFPGSIYIRLP
LSVETSLPINLKASNTCRKNVIMIVVGSYSMYLWPAGYVSEGTMQQLQRKMGYHVISSQF
RKFRYAELKKATKNFKEELGRGISSDVYKGVLADERVVIHCDVKPENILQDRIFELKIAD
FGLAKLTQRGNRSSLFSQIRRTKGSMAPEWALNHPITAKVDVYGYGVVILEIVKGIRLSS
WAVEDTDDQESELTRFVRVAKRKIHSGKDLWIKHVMDQRLQGQFSRIQVAKMVKIGISCV
EEEEQKTNHGFSSESAIAFESESGVACEGKSAVAHKC
Download sequence
Identical sequences MDP0000236651 MDP0000236651|PACid:22634860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]