SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000238744|PACid:22674921 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000238744|PACid:22674921
Domain Number 1 Region: 294-393
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.23e-24
Family B3 DNA binding domain 0.0073
Further Details:      
 
Domain Number 2 Region: 3-97
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.06e-23
Family B3 DNA binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000238744|PACid:22674921
Sequence length 417
Sequence
MRPPYFHKLIVSSTLQAKQLRIPESFVQKFRNELSTIATLTVPDGHVWHVGVKKVDNKFW
FHSGWQDFIEHYSIRVGYFLTFRHEGRSSFTVHIFNLKTAEINYQPNALSSTGGSVYRYQ
VFEEMEDDDSVEILGSSPTSIVTDSLKDKCFGDSANQLTPGKNCTPPSLQNLFNGSKPKN
CVNWSDAGNLHLSKGDDLQAGNESTRDIGVQFNVTELKKTVDEVKLRSPGEDIRSIKKTV
RKKRKVNPNVEESSSQHEKEVEIRFRFYESASARKRTVTAEERERAINAAKTFEPVNPFC
RVVLRPSYLYRGCIMYLPSCFAEKNLNGVSGFIKLQSADGRQWSVRCLYRGGRAKLSQGW
YEFTMDNNLGEGDVCVFELLKMKDIVLKVTVFRVLEDAGFVNQPQLQNLTPAKPNRN
Download sequence
Identical sequences XP_008362130.1.92800 MDP0000238744 MDP0000238744|PACid:22674921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]