SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000242546|PACid:22662348 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000242546|PACid:22662348
Domain Number 1 Region: 13-375
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.25e-25
Family GDI-like N domain 0.00092
Further Details:      
 
Domain Number 2 Region: 397-455
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.0000102
Family GDI-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000242546|PACid:22662348
Sequence length 555
Sequence
MSQLFDDRXPITPSTFDLIVIGTGLPGSVIAAAASTAGKAVLHLDTNQFYGGHFASLPLD
DLFPFLNSHASPPSSSSTTTTTTTITGHDDYTALPLTRRLLYSDIETVTYAPQALAQHNP
KRFYIDLSGPKVLFLADKATDLLWRSGVXPFLCFKGIEMKSIYDDIGELWNVPDSRVAIF
KDKRLSLMEKNKLMRFFKLVWQHLEAAXDEQGSEGNSESRKISDEDLESPFVDFLNRMEL
PHXIKSIILYAIAMVDYDQDNLEACKSILKTRDGIERLAVFYKSRLTNAPEAMIYPMYGH
GNLSGVISRRAAVKGCVCLQCLSMSEKSAMQAQRVPVAVLMDKDSGQYKGVRLASGQNLY
SDQLVMDPTFKVPSLPISSPPDVIASPQVLSLKHDKRKVARGICITTSSLKPDISNCLLV
YPPGSLYPEQDASIRAIQIGGSSAEVCPKGMYVFAKSIKSSHVYVHTAYAYMVQRVICLH
PFDKSVKLTFFRFVVYFSVLCDDAKQGKMLLHDAMNALLKLALSGNPYDRTLDSEDAEVK
PTLLWSMLYVQELST
Download sequence
Identical sequences MDP0000242546 MDP0000242546|PACid:22662348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]