SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000245472|PACid:22645295 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000245472|PACid:22645295
Domain Number 1 Region: 78-160
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000072
Family alpha-D-mannose-specific plant lectins 0.011
Further Details:      
 
Weak hits

Sequence:  MDP0000245472|PACid:22645295
Domain Number - Region: 435-468
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000116
Family Protein kinases, catalytic subunit 0.018
Further Details:      
 
Domain Number - Region: 308-340
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00392
Family Pan module (APPLE domain) 0.064
Further Details:      
 
Domain Number - Region: 145-243
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00513
Family WD40-repeat 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000245472|PACid:22645295
Sequence length 481
Sequence
MNTKPNSKFVFSVILLCAFLESHVSLAADTISENQSLSGNQTILSAGGMFELGFFKPGQL
SNYYIGIWYSKQVVSEMTVVWVANREIPVSDRFSSVLTILDGGKLGFNRITFHTQFLTSW
KNLEDPAPGLYSLELALDESNSYILLWNRSKQYWTSGSWDETLHMFNMVPEMRLSYIFNY
SYVTNENESYFTYSPNNPKIVPRYSMSASGQIHLLKMDNSKQWKLLWSQPRQCDVYASCG
AFSSCKPTSLNYCKCLKGFVPNRQSDWDLQIYTGGCSRRTSVKCGNATGDGFLKVNSEPS
PDNRQDEGALSIESCRSACLNECQCTAYAYDNGCSIWHGDVLNLHELEANDGDGRTLCIR
AAASDIKKKRNNSVIKPSLLIAIVSTITGLIVVXFGCFLWKKTMGKKREHRKNYNESKSK
FDVGGGGGKDDAELPIFGLRAIVAATNNFAEANKLGEGGFGPVYKVTLPPCALNTSSFFF
S
Download sequence
Identical sequences MDP0000245472|PACid:22645295 MDP0000245472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]