SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000248951|PACid:22626490 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000248951|PACid:22626490
Domain Number 1 Region: 35-355
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.48e-47
Family FAD-linked reductases, N-terminal domain 0.0000000107
Further Details:      
 
Domain Number 2 Region: 323-492
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.28e-30
Family GMC oxidoreductases 0.00000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000248951|PACid:22626490
Sequence length 607
Sequence
MEKSAIATRLLLLYFFVFCPQLGVHSFATPSNIQDFSYLKFVRNATDLPLQEKYDYIVVG
GGTAGCPLAATLSANYSVLLLERGDIPTAYPNVLSNAGILANFMQEDDGKTPAQRFTSED
GVAFVRGRVLGGSSMINIGLYSRADSEFLKKSGIKLDMNLVNNSYEWVENTLVFRPNLSH
WQSVVKDALLEAGVRPDNGLTLDHIQGTKITGTIFDDRGRRHGAVELLNKGHPKNLRVAI
HAAVERIIFSSKASGLSAKGIIYTDSYGRSHQALIRGKGEVILSAGAIGSPQLLLLSGVG
PKSYLSSLKIPVVHPQPYVGQFMRDNPRNYVTILPPSELEPSTAQIAGITSDYYIETVSG
LPFSTMAFSLFPNPTIPMTINSTFGHIVTKNPAPLSYGSLKLQSSYDVKVGPNVKFNYFA
NKADLSRCVSAVRKMGDLLKTNALKPFKTQDLPGEDGFNLFGPPLPMNRSDVASIETFCR
DTVATFWHYHGGCLVGKVVDGDFRVMGIKALRVVDGSVFKSLSPGTNPQATLMMLGRSLK
CSGMRMQEAVIASQQIVLLLGWLVELCMKIAQMLGNANARSCHYFSANCTITLGVMGSVY
DILKIFP
Download sequence
Identical sequences MDP0000248951 MDP0000248951|PACid:22626490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]