SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000254535|PACid:22679927 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000254535|PACid:22679927
Domain Number 1 Region: 198-288
Classification Level Classification E-value
Superfamily At5g01610-like 6.15e-21
Family At5g01610-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000254535|PACid:22679927
Sequence length 480
Sequence
MQEDGVDDVGDAGVDGVGDAGVDGVQKWKREREKKNHVSRNNSRRLRPPITVLHVINRLR
QRRRLAVCVRCNRRIQLSDGSAPEGRHRIRARQWQRPIPRVFERLLQLLAGRLVPAQVQV
HHYRHNLPEQALLADRGQRQGPVPVAXHRRGDPERRQPRVLGGDRVGGVSDRQFLRVPAV
RVRVGLRQWRTRRTPQRRSELSVYLNSTCRFTIDSYKLKYKSTITGVVTTDKISSLSGIE
VRVLFLWLSLVSVTRDDDELEXSVGIASANFPVSNFDESPTCGCGFDCVNGKRMIKNXVS
AXLEQQNNKTKFRRERKKNHVSRNNSRRPRPPITVVHVINRLRQRRWRRLAVCVRCNPRI
QLSDGSAPEGRHRIRARQWQRPIPRVFERLLQLLAGRLVPAQVQVHHYRHNLPEQALLAD
RGQRQGPVPVARHRRGXPEXXQPRVLGGDSVGGVSNRQFLRVPAVRVRVGLLQWRTSKED
Download sequence
Identical sequences MDP0000254535|PACid:22679927 MDP0000254535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]