SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000256497|PACid:22679396 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000256497|PACid:22679396
Domain Number 1 Region: 78-161,193-224
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.09e-27
Family alpha-D-mannose-specific plant lectins 0.0035
Further Details:      
 
Weak hits

Sequence:  MDP0000256497|PACid:22679396
Domain Number - Region: 366-396
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00537
Family Protein kinases, catalytic subunit 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000256497|PACid:22679396
Sequence length 396
Sequence
MDTKPNSKFVFSVILVCVFLESHVSLAADTISENQSLSGDQTIASAGGMFELGFFKPGQL
SNYYIGIWYSKQVVSEMTVVWVANREIPVSDRFSSVLTILDGNLVLLNMSKNPVWSTDLN
STTNSGSVQAVLLDSGNLVLKAGSSNNTLEPLWQSFDHPTDTLLPGGKFGFXKITNHSQI
LTSWKNLEDPAPGLYSLHLAPDEGDSCIYLWNRSRQYWTSGPWNESLRNFNMVPELRLFN
DFNYSSVRNENESYLTYSINNPKIGNGCSLWHGDVLNLHEVEANEGDRSTLYIRAAASDI
KEKRVIKPSLLIAIVSTITGLIVVVFGCFLWKKTTGKKREQKKNHNESKSKIDVGGGGGR
DDAELPIFGLRAVVAATNNFAEANXLGEGGFGXVYK
Download sequence
Identical sequences MDP0000256497 MDP0000256497|PACid:22679396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]