SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000263530|PACid:22651991 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000263530|PACid:22651991
Domain Number 1 Region: 14-126
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000292
Family FAD-linked reductases, N-terminal domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000263530|PACid:22651991
Sequence length 230
Sequence
MKERTVGRQERAEQIEQKNTTRVAVVGSGIPGAVCASTLGRNGVSVTLLESARVPGRRIC
REVVEDGKELLFDHCAPFFNAYNTKVLGLVHEWESKGLVACWKEKFGFFDHISNKFVDPE
EVQMGKILASLREWLQRTKTLFRSVPLKGFSIRSSEVLSWAHCXSSKPGRSTSREGPFPA
ASVAREEKCLWDKNKRLAICGDFCVSPNVEGAIASRIAAASKLTEILSSL
Download sequence
Identical sequences MDP0000263530|PACid:22651991 MDP0000263530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]