SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000267350|PACid:22676208 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000267350|PACid:22676208
Domain Number 1 Region: 141-395
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.9e-32
Family FAD/NAD-linked reductases, N-terminal and central domains 0.003
Further Details:      
 
Domain Number 2 Region: 405-496
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000000000165
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000267350|PACid:22676208
Sequence length 500
Sequence
MLPTKAAASEKSDGVVNIGALHTPDKXHQIAMNSDCRSKWRWSKTTNAVMKVLLASNIKE
QNQFTDRIGCRGDCAVSSDQRSKGYAAREFAKQGLKPGELAVISKEAVAPYERPALSKAY
LFPESPARLPGFHVCVGSGGERLLPDWYKEKGIELILNTEIVNADLPGKTLVSGSGESFK
YQTLVIATGSTVIRLTDFGVKGADAKNIFYLREIDDADKLYEAIKAKKNGKAVIVGGGYI
GLELGAVLKINNLDVKMVYPEPWCMPRLFTSGIAAFYEGYYQNKGVKIIKGTVATGFTAD
SNGEVKEVHLKDGTVLEADIVVVGVGGRPLTTLFKGQVEEEKGGIKTDAFFKTSVPDVYA
VGDVATFPLKLYNEIRRVEHVDHARKSAEQAVKAIKASEEGKTVEEYDYLPYFYSRSFDL
SWQFYGDNVGETVLFGDSNPATPKAKFGTYWIKDXKVVGAFLEGGTPEENQAIAKVAXAQ
PPVASLDQLAAEGLSFACKI
Download sequence
Identical sequences MDP0000267350|PACid:22676208 MDP0000267350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]