SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000268346|PACid:22678394 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000268346|PACid:22678394
Domain Number 1 Region: 79-127
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000622
Family FAD-linked reductases, N-terminal domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000268346|PACid:22678394
Sequence length 166
Sequence
MVIAFFAAQMAVEPKRPAQSTVKYVLYGDGTVVSNTLQLIGGIVGALVTISVAKPLFQIM
LKGRIHGFQNHGGETKKKMFTSVDCVVVGGGISGLCVAQVLATKHGDAVXIVIVTKAKDQ
VGGNIITIEKDGYAGAETWLRLEMKDPTKLSRGFGEDKQAGVYRIK
Download sequence
Identical sequences MDP0000268346|PACid:22678394 MDP0000268346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]