SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000268928|PACid:22663679 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000268928|PACid:22663679
Domain Number 1 Region: 14-148
Classification Level Classification E-value
Superfamily At5g01610-like 4.45e-39
Family At5g01610-like 0.0014
Further Details:      
 
Domain Number 2 Region: 323-553
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 8.33e-28
Family Haloperoxidase 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000268928|PACid:22663679
Sequence length 598
Sequence
MASGKQIVGEDKQRAGAEIVYGPEDCYRQSIDLLEELGFPKGVLPLQDLVECGRVRETGF
VWMKQKQPYEHFFEGSNTRVSYATEVTGYVEKCRMKKMTGIKSKQVFLWVPISEMSVEDP
XGKKIVFKTPMGIGKSFPVTAFMTEEEKQKYLEKNYYLTVYSQIVKERETLFVVFPKATP
QAIRCIQDQPTNGXSLPGLLTTSLLLPPRVPSPQLHXPLRLLLAPRHLIRRPHGPPVPRN
PRRRPRPLPPRPHHPDPTLRPVSRNRVXPPRRDHIRFVLQVHSRRQASPRVPPYCRRRRR
RPRLGLRRRPPLAPRFPSRHSPGSHMLLRAKSKGWRVVVFNSRGCGGSPVTTPQFYSASF
LGDMCEVVAHVGTRYPKANLYAVGWSLGANILVRYLGQESNACRLSGAVSLCNPFNLVIA
DEDFHKGFNNVYDKALASSLCKIFKKHALLFEDMDGEYNIPLAANAKTVREFDDGLTRVS
FGFKSVDDYYSNSSSSNSIKDVCTPLLCIQAENDPIAPNRGIPREDIKDNPNCLLIVTPK
GGHLGWVAGAEAPFGAPWTDPVVMDFLEHLQRGKFEAFSSSNLEGAHRSSEGLHSLEV
Download sequence
Identical sequences MDP0000268928|PACid:22663679 MDP0000268928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]