SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000275440|PACid:22630606 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000275440|PACid:22630606
Domain Number 1 Region: 621-921
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.36e-83
Family Protein kinases, catalytic subunit 0.0000995
Further Details:      
 
Domain Number 2 Region: 184-283,315-340
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.53e-22
Family alpha-D-mannose-specific plant lectins 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000275440|PACid:22630606
Sequence length 957
Sequence
MKDLINPQLITMCSSTNGFGQGTSKYHFAREGPFLEIACILIVGLTIIMWLIVVVSSIVL
AVFMNILIGLYASVVVYQDFSNWSLRSQVSSAIHSHAQKRQLESCLYQSTGYNWGVVRIN
EVELSTCTKGIRGLLIFLVIPPSSISVALDAITPNQPLRYGDVLLSATKIFALGFFSPGN
SHNRYIGVWYNNIPIQTIVWIANRDNPITPIAGTWLLAIHGDHGGLVIYGKDQNNPLWSA
NVTVSSPNNSVIAKLLDTGNLVLLENNGXSPRVLWQGFDYPSDTLLPLMKIGLNRRSGLN
RRLTSRKSXDDPGXGNFSYEIDPTGFPQLILYKGQTKWFRGGTWTGQRFSGIPEFTINSV
RSFVNDKDEIYMMYTVPNGSVFTRGVLDESGIVKRFVWRDQENKWIEVSSSPSEWCDXYG
QCGPNGNCDPYSNYNFSCLCLPGFEPKFPQDXYLRDGLGGCLRKLGASTCQKGEGFXKVA
RVKVPDSSKARVNMSLSLQGCEQECMKNCSCMAYARADERGGGKGCVMWYGDLIDTRTFS
NVGQDLYVRVDAVTXAQFANGSVISKKARLAISLLSALVFLGLVFLLCXLVRRKSKGRQR
KNMFFMEDRTDLDLDDQSKINSELQFFDQTTVAAATDNFSVANKLGKGGFGSVYKGVLHN
GKEIAVKRLSKNSGQGIEEFKNEVVIIAKLQHINLVKIIGCCVEDDEKMLIYEYVPNKSL
DCFIFDETKRYLLDWTKRFEIICGIARGILYLHQDSRLRIIHRDLKASNILLDASMSPKI
ADFGMARIFPRDQCEANTHRVVGTYGYMSPEYAMEGIFSVKSDVYSFGVLLLEIITGRRN
SGYYHKKYPHSNLVGYVWDLWREGNALEIVDPSIGESYHVNEVVRCIQIGLLCVQEFAAD
RPTMSAVVFMLGKEAAVPSPTQPAFLLKRSCTRVDPSTSTEGASSINDVTCTEIEAR
Download sequence
Identical sequences MDP0000275440 MDP0000275440|PACid:22630606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]