SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000277380|PACid:22666457 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000277380|PACid:22666457
Domain Number 1 Region: 537-640,680-882
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.81e-80
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 121-229
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.19e-22
Family alpha-D-mannose-specific plant lectins 0.0075
Further Details:      
 
Weak hits

Sequence:  MDP0000277380|PACid:22666457
Domain Number - Region: 11-40
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000392
Family Protein kinases, catalytic subunit 0.0078
Further Details:      
 
Domain Number - Region: 394-463
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.018
Family Anti-platelet protein 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000277380|PACid:22666457
Sequence length 906
Sequence
MSLGYATDEIFLMKSDVFSFGVILLEMLSRKKNRGFHHPDHYHNLLGHNSELDGALRSTS
CNDMPFNSVEATLGTITXXQYIRDGETLVSAGGGFELGFFSPGNSKGRYLGIWYTVSADT
VVWVANRETPLGDSSGFLKLXXQGVLVLLNSSDNIXWSSNSSRTVGNPVSQLLDTGNLIV
KDGNETNSDXFSWQXFDYPCDTFLPEMKLGWDLASXLERYVSSWKSTENPAPGDFSLRIX
XWGLPQLVTMKGAKIQARGGSWNGVHFTGYGSSGIRNSNPLPGVEFRLNKNEXYYEYRLL
NRSEFSRYVLNPLGITQRFTWVYQTQSWELSFTFQADQCENYALCGAYATCNINNAPICA
CLKGFAPKSPKDWNSGYWSGGCVRKTPLACSHGDGFLKYNGIKLPDTSTSWFNKSMSLKE
CKWLCLENCSCTAYANLDIRVGGSGCLLWFGNLIDIREFAISDVQDXYIRMAASELDHFX
KESKFNXKKLPILISFAVLLLGXIIVGLILYIRKKKLRNEGVRRXDFRKEYLGEDXELPL
FDLTTIAKATDNFSSSNKLGEGGFGPVYKGTLXGGKEVAVKRLSKDSGQGMREFKNEVKM
IARLQHRNLVKLLGCCTQEDEKILIYEFMPNRSLDFFVFGMIPSKTXHVAFRSYHPSPFK
LILPGFNVTLINMLKVSSDEEGRKLLNWXKCFHIIGGIARGLVYLHHDSRLRVIHRDLKA
SNILLDNNLNPKIADFGLAKIFDSDQSQASTNRVVGTYGYMSPEYAVDGIFSMKSDVFSF
GVILLEMLCRKKNRGFCHPDHHLNLLGHAWMLWXQDKQLELIDKTLSDSCNIYEVVRCLH
VGLLCVQRVPEDRPSMSSVVLMLSSDVALPSPKQPGFYTERSVSESPSSKRXCSENDVSI
XLIEPR
Download sequence
Identical sequences MDP0000277380 MDP0000277380|PACid:22666457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]