SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000279447|PACid:22623809 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000279447|PACid:22623809
Domain Number 1 Region: 322-444
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.1e-22
Family alpha-D-mannose-specific plant lectins 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000279447|PACid:22623809
Sequence length 498
Sequence
MGILMRSLVANRPRPNSKSISHQGRAHRPLRLPSLPQSTALSSLDGTRVESPALYPTRLD
LWSWLTHKKPANSPKPNTVFSSSSSSSSCSQSAXSTFTVNQTKVKQISWKPRAFVYEGLL
TDXECDHLIXIXKSELKRSAVVGNLFXXSKLIEKLREDSYADSGGESCSEVLXPAQPXLS
TVVSVSLPEETERMXRPTTLLHSASVASEGELRKNXTAEFMDSNIFQQQRLQQQQPXXLP
XFCCXSIRALCFCVLLLVFKTCIADEQHKDRIYPGFQASXVDXSDXVXLFLLSNNSAFAL
GFYQALDVKLYLLVIIHLGTDKVVWTANRGKLISKSAKFVFDKNGSAYLRGSDSVAWSTN
TTGXVASAMELQDXGNLVLLGDKXXILWQSFSHPTDTXLPGQEFLQGMQLKSFRNSDNVF
HYLEIQSGDLVLYTGYEPPXIYWSLAVGSRRSEREGRSSGSPRINPRCLCDIQPNPSSPL
ELHIRDAGKWCQLCRRVV
Download sequence
Identical sequences MDP0000279447 MDP0000279447|PACid:22623809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]