SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000281982|PACid:22629373 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000281982|PACid:22629373
Domain Number 1 Region: 61-230
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000475
Family GDI-like N domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000281982|PACid:22629373
Sequence length 437
Sequence
MLVLGQGFYVCMPIKSSNFMSKSSDHGLQFYNDVGVRWYGCRAMMLETVAVVPSMVTKVE
TISPPWDFVDTPCDYASYCGGCSQGSSNYMEALKSPLMGLIEKLIARKFILYVQDYSETD
PKTHEGMNLTRVTTRDLIAKYGLDDNNVDFIRHALALHRDDCYLNEPALDTMKRMKVEFN
EEGKVIGVTSEGETAKCKKVVCDPSYLPNKVRKVGKVARVIAIMSHPIPNTNESHSVLRV
CVEACKQNDDLSENYFFQVNDVWGGFGSNRFGFLPRMVVVLGLNAIVMVWTEIGLYIQEQ
FQGENLIDSVPWYEVLKDVVELRYTEGNRVVLFNCEWYDIVRKRTGYKIDHYGIISINTT
RKLNTKEPFVLANQATQAFYVREIKNKTWSYVVETKPRNVYEMPNVDDDDDEPYQEEEAH
GGIQANQNDDEDDEIVG
Download sequence
Identical sequences MDP0000281982|PACid:22629373 MDP0000281982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]