SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000283269|PACid:22680036 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000283269|PACid:22680036
Domain Number 1 Region: 73-166,194-211
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.67e-29
Family alpha-D-mannose-specific plant lectins 0.0035
Further Details:      
 
Weak hits

Sequence:  MDP0000283269|PACid:22680036
Domain Number - Region: 275-327
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0751
Family alpha-D-mannose-specific plant lectins 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000283269|PACid:22680036
Sequence length 444
Sequence
MLSPTFTMSSLLSLFLFSLFAFNAQAQVPANQTFKFVNEGEFGPYIVEYDGNYRMLNVYS
SPFQLAFYNTSPNAFTLALRMGTTRSESLRRWVWEANRGNPVGENATLAFGTDGNLVLAD
ADGRVAWQTNTANKGVVGFKLLPTGNMVLHDSKSNFVWQSFDHPTDTLLVGQSLRARAVN
KLVSRASETENKDGPYSIVMESKSISLYYKSNNSPKPLLYTQFSITDVTPAKSVFDRVTF
NCAPETDEGHAYDLTLQFEVVNPTLAGGHILARPKYNSMLTFLRLEIDGNVKLYTYDDNV
DWGAWEVTFTLFDRDNWLWETNECQLPERCGTFGLCEDSQCVACPSSKGLLGWSKTCKPE
KLTSCDAKSFHYYKVGGVDHFLSKYTKGEATKEANCAKKCTSNCKCLGYFYNKDTSRCWI
AYDLKTMTKVANSTHVAYIKAPNH
Download sequence
Identical sequences XP_008386254.1.92800 MDP0000283269 MDP0000283269|PACid:22680036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]