SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000284402|PACid:22634996 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000284402|PACid:22634996
Domain Number 1 Region: 73-166,194-211
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 7.07e-29
Family alpha-D-mannose-specific plant lectins 0.0035
Further Details:      
 
Weak hits

Sequence:  MDP0000284402|PACid:22634996
Domain Number - Region: 275-327
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0771
Family alpha-D-mannose-specific plant lectins 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000284402|PACid:22634996
Sequence length 444
Sequence
MLSPTFTMSSLLSLFLFSLFAFNAQAQVPANQTFKFVNEGEFGPYIVEYDGNYRMLNVYS
SPFQLAFYNTSPNAFTLALRMGTTRSESLRRWVWEANRGNPVGENATLAFGTDGNLVLAD
ADGRVAWQTNTANKGVVGFKLLPTGNMVLHDSKSNFVWQSFDHPTDTLLVGQSLRAXAVN
KLVSRASETENKDGPYSIVMESKSISLYYKSNNSPKPLLYTQFSITDVTPAKSVFDRVTF
NCAPETDEGHAYDLTLQFEVVNPTLAGGHILARPKYNSMLTFLRLEIDGNVKLYTYDDNV
DWGAWEVTFTLFDRDNWLWETNECQLPERCGTFGLCEDSQCVACPSSKGLLGWSKTCKPE
KLTSCDAKSFHYYKVGGVDHFLSKYTKGEATKEANCAKKCTSNCKCLGYFYNKXTSRCWI
AYDLKTXTKVANSTHVAYIKAPNH
Download sequence
Identical sequences MDP0000284402|PACid:22634996 MDP0000284402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]