SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000295597|PACid:22673908 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000295597|PACid:22673908
Domain Number 1 Region: 101-212
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.06e-28
Family alpha-D-mannose-specific plant lectins 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000295597|PACid:22673908
Sequence length 500
Sequence
MAWASDRLILYCPRCCCDCAKGLIHASAKKMLLKALLVVSLLFPFCTSIDTIEMDQHVKD
GDLLVSKENIFALGFFSPRNSSSRYVGIWYAQKDEKDQKAVVWVANRNDPINDTSGVLTI
DRYGRLLLYSNNMQNIPVWSTNVTVQTATTSCRAQLLDSGNLVLFWDNKRKNFMWQSFDY
PTDTILPGMKLGMNWKLGIEWVLTSWKSQDDPGTGEYTERLYSNQTATVEIFVFYKNLTP
HWRSGPVDQWRSHPVGVGTYVSNQDEMYYSYKNDSTSIRGVLKDSGLLQSLRWNNADREW
KELWSGPKYRCDLYGECGANSKCTPDNVNLFACECLPGYEPKSVNDWNMRDGSDGCVSKR
VAVSKCRNGEGFMKVARVKDPDTTKAAWLEKGISAKECEQVCLSNCSCTAYMVLESEGRS
DCLTWYGELLDILVYTEVGQDLHVRVDKIELAENSRNSKGFLRRRGMLAILMLCVLLALV
LMVALTCWRIRKQRKTKGKK
Download sequence
Identical sequences MDP0000295597|PACid:22673908 XP_008371239.2.92800 MDP0000295597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]