SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000296700|PACid:22644286 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000296700|PACid:22644286
Domain Number 1 Region: 487-683
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.79e-59
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 2 Region: 87-193
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.27e-19
Family alpha-D-mannose-specific plant lectins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000296700|PACid:22644286
Sequence length 697
Sequence
MAARRSFLLLFFSCFFMQYLPPCYAEIVLYTLKQGEQLRDQESDHLVSQRGDFKLGFFSP
GASSNLGATSNRFLGIWYSKLPNHPDAVWVGNPETPVVDSSGVFVLDSDGKMKIKHGGGE
IIVWDYNQTXSGNVTGYMMDTGNFMLREVASDGTPGKILWESFDYPSNTLLPGMKLGLDL
RTGRNRTISSWFSDQVPTPGAFRLSVDPSSTNRLIIWRRDVVYWTSGIWESGSFQRAPEL
TSRADLFEFNFVSNAEEKYFTYTVKNNSTLSRWELNTWGQLMQSILGSDGTTWETTATSP
CTSNPNYLDAVCIKQTTSECRNGSELFLPMRGYSXDAKLTYNDSNTNLDLSDCHATCWSD
CTCVGYGPLYHNGSGCLYMREGVHYVKXDYFXVNYFATIANNSRDGAPTEKGSTKREWWI
WCIVGIVIXVALLLLGYFCYTRKRKLQQVQQTDKAETIQEQGLLDLGSQIXGLGDIFKLK
FGKSRGLEFKMFSFPELVTATDDFSFARRLGEGGFGPVYKGVLPDGQQVAVKRLARHSGQ
GLEEFMNEITLIAELQHSNLVRLLGCCIQGEEKILIYEYLTNTSLDAFLFDSTRVYLLDW
QRRINIIEGIAQGLIYLHKHSRISDFGMARIFGQNESRANTNRVVGTYGYMSPEYAMNGI
FSEKSDVYSFGVLLLEIVSGRKNTVFVSSTNLSLIEL
Download sequence
Identical sequences MDP0000296700 MDP0000296700|PACid:22644286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]