SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000296714|PACid:22644308 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000296714|PACid:22644308
Domain Number 1 Region: 676-1019,1122-1166
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.68e-69
Family FAD-linked reductases, N-terminal domain 0.0000178
Further Details:      
 
Domain Number 2 Region: 1001-1112
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 6.54e-29
Family L-aminoacid/polyamine oxidase 0.00035
Further Details:      
 
Domain Number 3 Region: 1860-1929
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 3.27e-18
Family F1F0 ATP synthase subunit C 0.0048
Further Details:      
 
Domain Number 4 Region: 418-513
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000296
Family SWIRM domain 0.038
Further Details:      
 
Domain Number 5 Region: 1251-1336
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0000418
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.017
Further Details:      
 
Weak hits

Sequence:  MDP0000296714|PACid:22644308
Domain Number - Region: 1796-1850
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 0.000902
Family F1F0 ATP synthase subunit C 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000296714|PACid:22644308
Sequence length 1938
Sequence
MVDKMDGEEKKSGLQIRSKFVKANMVDSEDDEPIGSLLKLKRQRNLKKVKGGGERGKMVD
DEEENLGGLDDTLASLRKKLKGPKKDYGTGTMRGRSFALDGVQSVDQSSNXHVDDXGLDG
KSXSRVLEKDPVMGSNCLLDHHPEDSLSAFSRKSQSGLIMNSRASSXPKEKSGSKVLEDG
LNTMPLAGSNQLDSASDQCKEDESQSFDDRASNRHRENQETFNDKKHKRPYKVVSEDRVP
XYSHSGFDSKLIXNEAIVDPSGSNFQEGPCSSDEVNDGDKKHLTQXMQTFEDGLKNCSMG
GNCNGLISYTKNLGLASGPLRDENDVPNHDHLITSEEADENESFPEDTVSLPDVENKNTK
LSAVQRVGRIVRKRRHGDMAYEGDADWEVLINDQSLNSDNLRVKFDSSSSIGTESESGEA
AAVSAGLKAHAVGPVEKIKFKEILKRRGGVQDYLECRNQILALWNKDVSRILPLADCGVT
YTACADEPPRASLIRDIYTFLDLSGYINIGIAREKDKAESGPKHDYKILREKNFEEIFGV
SVADSEDGVSFITGQVKSSRTKTDAKSGVIIKSDNSTHEVTKDNGLVTTAALELSNTKNH
AECEADHPENTSVDARLQSKLDNMDVSSSDPISETLGDGGIPLETPELKNVSHSTQCASQ
DHAVRNNNPQCGLEVKKKIIVIGAGPAGLTAARHLQRQGFSVTILEARSRIGGRVYTDRS
SLSVPVDLGASIITGVEADWATERRPDPSSLVCAQLGLELTVLNSDCPLYDIATGEKVPA
DLDEALEAEFNSLLDDMVLLVAQEGEQTRMSLEKGLEHALKRRRMAKTSTSVEEKELHDL
MDGFIDAKKNIDRAKKSCQKLELLSPLERRVMDWHFANLEYGCAAPLKEVSLPNWNQDDV
YGGFGGAHCMIKGGYSTVVESLGEGLHIHLNHVVTDISYVTKDAGLNTNRCNKVKVSTSN
GSDFSGDAILITVPLGCLKAETIKFSPPLPHWKHSSILRLGFGVLNKVVLEFPDVFWDDS
VDYFGATAEETELRGQCFMFWNVKKTVGAPVLIALVVGKAAIDGQNMSSSEHVNHAIVVL
RKLFGEASVPDPVASVVTDWGKDPFSYGAYSYVAVGASGEDYDILGRPVENCLFFAGEAT
CKEHPDTVGGAMMSGLREAVRIIDILTTGNDYTAEADAIAGIQRQSDSERAEVRDITRRL
DAVELSDVLYMNKEALLQDMFFNAKTTKGRLHLAKELLSLPVETLKSFAGTKEGLTTLNS
WILDSMGKAGTQLLRHCVRLLVLVSTDLLAVRLSGIGKTVREKVCVHTSRDIRAIASQLV
NVWLEVFRKEKASNGALKLSRQATAADALRRKPIKDPSSGKPPLHTFHGDLEHKGSLQDS
ASTASHLPLNANGKKVNGKPIKGETANSSKSEINSSRFRGSTGRPHSELKENDVAVTEAE
QAAIAAAEAARAAALAAAEAYASSEAKSGTLLQLPKIPSFHKFARREQYPQMDEYDFRRK
WSGGDLGRQDCISEIDSRNCKVRDWSVDFSATCVNIDSSRMSVDNLSQRSNPNETGSQTN
IREHSGESAAVDSSIYTRAWVDTAGSAGIKDYHAIEMWQSQAAAVDPDFFHPEPYIHDEE
GSNTTSRKHSWKHEGHVNEGSVSQVTVNKESLKNHHRGADNIKQAVVDYVASLLMPLYKA
KKIDREGYKSIMKKSATKVMELATDSEKAMAVYEFLDFKRRNKAGIDVFGCSEEARVSVF
NDFEMNYVLPSVIKPFLAPPESRLIRGLGCLLRQPSHGRWDPHAFTHLGVGPTSRYSASC
MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSY
YLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALY
GLIVGIILSSRSGQSRAD
Download sequence
Identical sequences MDP0000296714|PACid:22644308 MDP0000296714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]