SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000304352|PACid:22643879 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000304352|PACid:22643879
Domain Number 1 Region: 799-854
Classification Level Classification E-value
Superfamily ENT-like 3.53e-18
Family Emsy N terminal (ENT) domain-like 0.0035
Further Details:      
 
Domain Number 2 Region: 373-448
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000072
Family alpha-D-mannose-specific plant lectins 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000304352|PACid:22643879
Sequence length 1017
Sequence
KMRGIDEAPHDIENPKDPLLEELQNLFRLSPLRCIYRVPERLRRGNENAYTPQVVSIGPL
HHGKPQLKAMEEHKKRYLRHFLSRTRERVSFSDYIKKIKGQERRLRHFYAEPIEFGSDEF
VRIVLVDAAFVIEFLLRYCSKXCEDDYIFNKPEMLWDVRPDLRLLENQLPFFIVQDLFNT
LLPSSHQLPSLLEISYNFFKSEIDSKGKEEKFKQICSFGDKEXTTPTHNVTELCQAGVEF
AGGTGSDLFDIKFSRANGILEIPKLTVNDTTDLTLRNLLAFEQCHHSEENYLTNYVFLMM
CLVKTPEDVELLVEKGIVENWLGDTQKISTLLHDLGNGMMLLHAQSPQFDILETSKLWFQ
MVEAFKWDSTDAVVLVANRETSLDDSSGLLKLTEIAGNPVSQLLDSGDFVVQIGNETNPD
NLLWQSFDYPCATFLPEMKIGWDLDTGLARYASLLIRRFDFLVVTGFDVXVGIMRFKXGS
KVEVLSQKEVPGGAWRCAVIVSGNGHTYSVSYXWSGKDSQAIVQRVSRKDIRPCPPPVQR
XEIWAVGDVAEVFDVGFWKMATVLKVLDENYYLARVLGSFEEFRVHKYRIRARQLWNDDK
WVGIGKGPDNRMSLQVXQMNAKIKLPARNNRLXSLYNISCQDSHSVSSGSLKRASPYSSS
VEGYSXKMRAIEKGCEHQRVFSGSPSYLLKKVDAVAYPRENLGEKDMHTSFINRTTGCVE
KEREKLNGVISCFVERSSELNDTDSDACSVGSCSVISSSSNKLFGHNVAGTSQDADTLSS
DAESFCCCXDAQENLSLPLKEDVAAGIHRLELNAYRSTLVAMHASGSLSWEQEALLTNLR
ISLHISNDEHLMEVIPTSREKXKERTKLLSAKSFLGTRRFDVGAKNXFRWQSHERILRDS
VIYVWRSTKFISKETGWIKALKLTGICPDRLLSDKFKEVVVHEVQDLELSXTTXFMRNXX
XKHVXTEAGLPNVKGFYQSMLQGVXFEFEAMQXTLMXPDAKNLETRWIVGREEANPX
Download sequence
Identical sequences MDP0000304352|PACid:22643879 MDP0000304352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]