SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000307829|PACid:22650676 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000307829|PACid:22650676
Domain Number 1 Region: 482-762
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-78
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 113-223
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.14e-27
Family alpha-D-mannose-specific plant lectins 0.0061
Further Details:      
 
Weak hits

Sequence:  MDP0000307829|PACid:22650676
Domain Number - Region: 393-446
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0239
Family Pan module (APPLE domain) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000307829|PACid:22650676
Sequence length 792
Sequence
MTVNIQSLFDSSHACQLPGKLVHSNKQQKFIVDAKSQIPXRKMLFFKPLFLFFLLLMPFC
TSIDTIALNQQLKDGDTLVSKDRKFEXGFFSPDNSSSSTYVGIWYXDQPQKTVVWVANRD
TPVNDSSGVLAINRYGNLVLSAAGNILIWSTNVSVHVQTRSTFVAQLLDSGNLVLFQENK
SEXFIWQSFDYPTDTLLPGMKIGFNWKSGLELKLTSWISENNPGTGDYSFRIVSNSTATP
LIVVFKGLSKYWRADPGVWPNFVXNDEEMYDYFTPRENGSVARAVLRDYGLFQQLKWSDA
DDQWEETFAAPKYRCDKYGQCGANSICSPDNVNLFECECLPGYXPKSVNXWNQRNGSDGC
VSKRIGGLKCGNGDGFVTXQRVKDPDASIEAXLVKSMSDKECEQACLXNCSCTAYMSIGS
EGRIDCMTWYDDLMDILVRTELGGDLYVRVDKIELGSDFAGLVSTDYVEVDELEETRRHP
ELQYFDLSTILVATDNFSLVNKLGQGGFGTVYKGQVPNGQIIAVKRLSRTSGQGVKEFKN
EVALIARLQHRNLVKLLGCCVKGEERILVLEHLPNKSLDYFLFDHRRRSLLEWDKRFEII
NGVARGILYLHQDSRVRIIHRDLKTSNILLDAEMNPKISDFGMARIFQGDQLQDKTNRIV
GTYGYMSPEYAVFGRFSTKSDVFSFGIXLLEIVWQLWREDRALEIVDSSLESYQSEEVVR
CIQVGLLCVQEDPEDRPTMAAVVFMLSGEASPPGPKQPAFVFRSKPCSNADPSVSKESCS
INDLTITKFQAR
Download sequence
Identical sequences MDP0000307829 MDP0000307829|PACid:22650676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]