SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000314606|PACid:22664349 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000314606|PACid:22664349
Domain Number 1 Region: 67-267
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.02e-27
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.065
Further Details:      
 
Domain Number 2 Region: 242-334
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.000000804
Family D-aminoacid oxidase-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000314606|PACid:22664349
Sequence length 556
Sequence
MATATRLRRLGAAACVATAASGAFLLQPSFSANDRGNGPSSLGAVRQRISDPNAVVPSRA
AQEAALISASASNPLDILVIGGGATGSGVALDAVTRGLRVGLVEREDFSSGTSSRSTKLI
HGGRRIAYVHSYTTTTLTCVQILSAQESVELFXTLARKMNDARLNVGLACTAAVAGAAVX
NHAEVVALLKDEASNRTIGARIRDNLSGKEFDIYAKVVVNAAGPFCDSLRKMADQDAKPM
ICPSSGVHIVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTIAGTTDSNTSITLLPEPH
EDEIQFILDAICDYLNVKVRRTDVLSAWSGIRPLATDPSAKSTESISRDHVVCEDYPGLV
TITGGKWTTYRGMAEDAVNAAIKSGNLTPENGCLTSKLQIVGGDGWDPASFTVIAQQYVR
MKNSHGKVVPAVMDTAAARHLSHAYGTFAERVAAIAQNENLGKRLAHGYPFLEAEVAYCA
RNEYCESAIDFIARRSRLAFLDTDAASKALPRVIEILATEHKWDNSRQKYELEKAKEFLE
TFKSSKNAQFHDGKHV
Download sequence
Identical sequences MDP0000314606 MDP0000314606|PACid:22664349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]