SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000315409|PACid:22681973 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000315409|PACid:22681973
Domain Number 1 Region: 1-288
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.04e-60
Family GDI-like N domain 0.0000000143
Further Details:      
 
Domain Number 2 Region: 291-388
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.28e-39
Family GDI-like 0.0001
Further Details:      
 
Domain Number 3 Region: 389-445
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000298
Family GDI-like N domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000315409|PACid:22681973
Sequence length 457
Sequence
MDEEYDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLNQLWKXFRGEDK
PPETLGSSREYNVDMIPKFMMANGALVRVLIHTDVTKYLNFKAVDGSFVYNKGKVHKVPA
NDVEALKSPLMGLFEKRRARKFFIYVQDYDENDPKSHEGLDLNKVTARELISKYGLDDNT
VDFIGHALALQQDDNYLAEPAMDFVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFAR
LSAVYGGTYMLSKPECKVEFENGKAIGVTSEGETAKCKKVVCDPSYLPNKVKIVGKVARA
ICIMSHPIPNTNDSHSVQVILPQKQLGRKSDMYLFCCSYSHNVAAKGKYIAFVLTEAETD
NPQVELKPGTDLLGAVDEIFFDTYDRYEPTNQGDGDNCFISAVRMNEFLHLHLIIISYDA
TTHFETTVQDVIAMYSKITGKALDXSVDLSAASAAEE
Download sequence
Identical sequences MDP0000315409|PACid:22681973 MDP0000315409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]