SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000316310|PACid:22644226 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000316310|PACid:22644226
Domain Number 1 Region: 65-159,187-204
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.22e-31
Family alpha-D-mannose-specific plant lectins 0.0027
Further Details:      
 
Weak hits

Sequence:  MDP0000316310|PACid:22644226
Domain Number - Region: 362-409
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0349
Family Pan module (APPLE domain) 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000316310|PACid:22644226
Sequence length 432
Sequence
MSPLLSLFLFSLFAFVAQAQVPANQTFKFVNEGEFGPYIVEYDGNYRMLSVFSSPFQLAF
YNTTPNAFTLALRMGLTRSESLFRWVWEANRGNPVGENATLAFGEDGNLVLADADGRVAW
QTNTANKGVVGFKLLPTGNMVLYDSKGNFVWQSFDHPTDTLLVGQSLRPGTINKLVSRVS
ETENKDGPYSLVMEPKGIFLYYKSNNSPKSILYSQLFTIEKGSLDHVTLNVAPDTDEGYA
YDISLEYQVANSSSGGNAILARPKYNSTLTFLRLGIDGNVKLYTYYDKVDWRAWEVTFTL
FDRDNSIWETECQLPERCGNFGLCEDSQCVACPSSKGLFGWSKACEPEKLASCAANSFHY
YKVEGVDHFMSKYTRGTAIKETDCGKKCTSDCKCLGYFYNQDTSRCWIAYDLKTLTKVAN
STHVAYIKTPNQ
Download sequence
Identical sequences XP_008386249.1.92800 MDP0000316310 MDP0000316310|PACid:22644226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]